Query_name: sp|Q7TFA0|NS8A_SARSORF8aproteinOS=SevereacuterespiratorysyndromecoronavirusOX=694009GN=8aPE=3SV=1
Query_length: 39

SEQ  MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH
SS3  CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
     940235555555655555555421478720147765679
SS8  CCCHHHHHHHHHHHHHHHHHHHHHTCCCEEECCCCCCCC
     950235555667766666666542002301113111379
SA   EEEEEEEEeEEEEEEEEEEEEEbEEEEEEEEEEEEEEEE
     644321210223030311212201434130122305358
TA   HHHHHHHHHHHHHHHHHHHHHHHgTBEEEEeEEEEebhH
     134566655655556666666543223110000022329
CD   ccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcN
     102455445555656656676576223344420120001




Query served in 100934 seconds

Response available at the URL: http://distilldeep.ucd.ie/~gianluca/distill_results/query158745483631995.html


Quick explanation of output formats

SS3 line - 3 class secondary structure:
H = Helix   (DSSP classes H, G and I)
E = Strand  (DSSP classes E and B)
C = Coil    (DSSP classes S, T and .)

SS8 line - 8 class secondary structure:
classes as per DSSP, except . -> C

SA line - 4 class relative solvent accessibility:
B: very buried (under 4% exposed)
b: somewhat buried (5-25% exposed)
e: somewhat exposed (26-50% exposed)
E: very exposed (over 50% exposed)

TA line - 14 class structural motifs:
Refer to http://distilldeep.ucd.ie/brewery/quickhelp.html for explanation of letters

CD line - 4 class contact density :
N: very low density
n: low density
c: high density
C: very high density

The lines following the SS3, SS8, SA, TA and CD lines are confidence values for the predictions,
with 9 = maximal confidence and 0 = very little confidence.




Please cite one or more of the following:

M.Torrisi, G.Pollastri.
"Brewery: Deep Learning and deeper profiles for the prediction of 1D protein structure annotations",
Bioinformatics, 1367-4803, 2020.

M.Torrisi, G.Pollastri.
"Protein Structure Annotations",
in Essentials of Bioinformatics, Volume I. Understanding Bioinformatics: Genes to Proteins,
Springer Nature, 2019.

M.Torrisi, M.Kaleel, G.Pollastri.
"Deeper Profiles and Cascaded Recurrent and Convolutional Neural Networks for state-of-the-art Protein Secondary Structure Prediction",
Scientific Reports, 9: 12374, 2019.

M.Kaleel, M.Torrisi, C.Mooney, G.Pollastri.
"PaleAle 5.0: prediction of protein relative solvent accessibility by deep learning",
Proteins, 2019.

M.Torrisi, M.Kaleel, G.Pollastri.
"Porter 5: state-of-the-art ab initio prediction of protein secondary structure in 3 and 8 classes",
bioRxiv 289033, 2018.

C.Mirabello, G.Pollastri.
"Porter, PaleAle 4.0: high-accuracy prediction of protein secondary structure
and relative solvent accessibility",
Bioinformatics, 29(16):2056-2058, 2013, doi: 10.1093/bioinformatics/btt344

G.Pollastri, A.McLysaght.
"Porter: a new, accurate server for protein secondary structure prediction".
Bioinformatics, 21(8):1719-1720, 2005.

C. Mooney, G.Pollastri. "Beyond the Twilight Zone: Automated prediction of
structural properties of proteins by recursive neural networks and remote
homology information", Proteins, 77(1), 181-90, 2009.

G.Pollastri, A.J.M.Martin, C.Mooney, A.Vullo. "Accurate prediction of
protein secondary structure and solvent accessibility by consensus combiners
of sequence and structure information", BMC Bioinformatics, 8:201, 2007.
